PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0012s0198.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family ARR-B
Protein Properties Length: 758aa    MW: 81601 Da    PI: 6.33
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0012s0198.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.53e-28243296155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           kpr++W+ eLH++Fv+av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Sphfalx0012s0198.2.p 243 KPRVVWSVELHQQFVSAVHQL-GIDKAVPKRILELMSVHGLTRENVASHLQKYRL 296
                           79*******************.********************************8 PP

2Response_reg80.84.6e-27571651109
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           vl+vdD+p+ +++l+++l +  y +v+++  +++alell+e +  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a ge + + 
  Sphfalx0012s0198.2.p  57 VLVVDDDPICLMILERMLHQCSY-QVTTCGRATKALELLREDKdkFDLVISDVYMPDMDGFKLLELVGL-EMDLPVIMMSADGETSAVM 143
                           89*********************.***************888778*******************87754.558**************** PP

                           HHHHTTESEEEESS--HHHHHH CS
          Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                           + +  Ga d+l Kp+  eel++
  Sphfalx0012s0198.2.p 144 KGITHGACDYLLKPVRLEELRN 165
                           ********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.85E-3754176IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23004.8E-4454189No hitNo description
SMARTSM004481.4E-3255167IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011045.54556171IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.8E-2457166IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.10E-2958171No hitNo description
PROSITE profilePS5129411.526240299IPR017930Myb domain
SuperFamilySSF466894.48E-19240300IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-29242301IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-24243296IPR006447Myb domain, plants
PfamPF002492.8E-7245295IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0009873Biological Processethylene-activated signaling pathway
GO:0010082Biological Processregulation of root meristem growth
GO:0010119Biological Processregulation of stomatal movement
GO:0010150Biological Processleaf senescence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 758 aa     Download sequence    Send to blast
MASVQHPLSH QLLPGHEQQR QQQQYGGAST GTHNMLQAHN YHKDVDSVDE FPAGLRVLVV  60
DDDPICLMIL ERMLHQCSYQ VTTCGRATKA LELLREDKDK FDLVISDVYM PDMDGFKLLE  120
LVGLEMDLPV IMMSADGETS AVMKGITHGA CDYLLKPVRL EELRNIWQHV LRKKRTGAKD  180
VEHSTSHEEG ERRKFGGGED VEYTSSATDT TDGNCKLMKR RKEMKEDDED TEQENDDPST  240
LKKPRVVWSV ELHQQFVSAV HQLGIDKAVP KRILELMSVH GLTRENVASH LQKYRLYLRR  300
LSGVTSQQNG MNVMFGGSET AFGHVSSLDS IGNLRTLAAT GQLSPQTLAG VHASRIGREG  360
SPNCMGLPSS LDPSMSAQIA APPRPHMNGG LFGTQSCSVQ SLAGGVDVDP ILQLHNLSAM  420
GRLHQLDDIP GLRSLQHQLV GTSAGNCNTL GLNPVGGPSV NLVGRPSSEA LLMQLFQQRA  480
QQQGGGLSVH LPQPSAVLGT PCLLSTGVNL GKAGSLADMG REFGSSLGAA VASIPSSLGS  540
LVQPPDVGVQ TSNLVGSLGG SFNGSATVLS PTIGGAPGPS KMNDMPRPQH SMKTSLNPLG  600
QASHMHGQVL SQSSRPTWLG SRGMVFAEQG QSIESGLSPW FPSQNQAHVG RFAENLQQLG  660
QPDYTGQGMN FPVSLGLDIK PSIDGSQGQS GQPATCSEQK LLKDERASDN IIITKVDGGL  720
VPHDQSEDLL TFFFKQSHDG ISFPDSDGYR VDNFYVK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-21242302464ARR10-B
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00054PBMTransfer from AT4G16110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010271367.11e-139PREDICTED: two-component response regulator ARR2-like isoform X1
RefseqXP_010271366.11e-139PREDICTED: two-component response regulator ARR2-like isoform X1
STRINGPP1S362_27V6.11e-168(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-115response regulator 2